PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000512279
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 396aa    MW: 44233.2 Da    PI: 5.5522
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000512279genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ3193.1e-981463511209
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pp saf +pkcalw+c+rp++    +qd css ha+la neglpg tpvlrp+gi lkdg+lfaal+ k+qgk+vgip c+gaat +spw+ +elf
  MDP0000512279 146 PPASAFKRPKCALWECSRPVHV--LCQDXCSSGHAHLARNEGLPGKTPVLRPWGIALKDGSLFAALNDKTQGKDVGIPDCDGAATLRSPWDDPELF 239
                    789*****************86..6*********************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    dl l eget rewlff +prrafesgnrk+r l +y+gr wh sr q m e+gg+krsyymdpqpss  ewhl+eye+n++da+alyrlelk   +
  MDP0000512279 240 DLXLXEGETPREWLFFGRPRRAFESGNRKRRXLQNYRGR-WHVSRTQEMMEYGGQKRSYYMDPQPSSDREWHLFEYEVNNSDACALYRLELKFGTA 334
                    **************************************9.******************************************************** PP

            VOZ 193 kksakgkvskdsladlq 209
                    kks+kgk s+d++  l 
  MDP0000512279 335 KKSSKGKQSNDPVGRLT 351
                    ************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-5242325IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MTKESKGKCE AASHKLLKEK AKTRVQKLRG MFTNIQIARK EGRTADMAIF EDQMDQMLGG  60
WIAELNDPSI ASSLHGGSDG RLESFSDDLA RFSKQQCDEK DDAESPLKDL PQPNLEGPEP  120
EGPPEDXFQD LEFPDVVPDV MPDICPPASA FKRPKCALWE CSRPVHVLCQ DXCSSGHAHL  180
ARNEGLPGKT PVLRPWGIAL KDGSLFAALN DKTQGKDVGI PDCDGAATLR SPWDDPELFD  240
LXLXEGETPR EWLFFGRPRR AFESGNRKRR XLQNYRGRWH VSRTQEMMEY GGQKRSYYMD  300
PQPSSDREWH LFEYEVNNSD ACALYRLELK FGTAKKSSKG KQSNDPVGRL TAEASTEVGN  360
NSKGTTSKNA EAGNIFGSDN QTNSLYLNPE MSWKC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.112080.0bud
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353772.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_008353773.10.0PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ08e-96VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM5WU251e-145M5WU25_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00500.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.22e-89vascular plant one zinc finger protein